Snaclec Rhodocytin Subunit alpha, Recombinant, Calloselasma Rhodostoma, aa1-136, His-Tag
Price range: $ 615.06 through $ 1,492.77
For reserch purpose only
Catalog No
USB-375346
Supplier
US Biologicals
Size
1 mg > 10 µg
Product Overview
Product Properties
Target Gene
Product Overview
Product Specifications
| Description | Elicits platelet aggregation by the binding to the C-type lectin domain family 1 member B (CLEC1B/CLEC2). Binding leads to tyrosine phosphorylation in the Cytoplasmic domain tail of CLEC1B, which promotes the binding of spleen tyrosine kinase (Syk), subsequent activation of PLC-gamma-2, and platelet activation and aggregation. Binding to GPIbalpha (GP1BA) and alpha-2/beta-1 (ITGA2/ITGB1) may also induce aggregation, but this is controversial. Source: Recombinant protein corresponding to aa1-136 from calloselasma rhodostoma Snaclec rhodocytin subunit alpha, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~17.8kD AA Sequence: GLEDCDFGWSPYDQHCYQAFNEQKTWDEAEKFCRAQENGAHLASIESNGEADFVSWLISQKDELADEDYVWIGLRAQNKEQQCSSEWSDGSSVSYENLIDLHTKKCGALEKLTGFRKWVNYYCEQMHAFVCKLLPY Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. |
| Purity | ~90% (SDS-PAGE) |
| Form | Supplied as a liquid in Tris, 50% glycerol. |
Product Properties
| Source Antigen | Recombinant, Yeast |
| Grade | Highly Purified |
| Molecular Weight | 17.8 |
| Storage Instructions | -20°C |
| Reactivity Life | 6 months |
Target Gene
NA
