Snaclec Rhodocytin Subunit beta, Recombinant, Calloselasma Rhodostoma, aa24-146, His-Tag
Price range: $ 615.06 through $ 1,492.77
For reserch purpose only
Catalog No
USB-375347
Supplier
US Biologicals
Size
1 mg > 10 µg
Product Overview
Product Properties
Target Gene
Product Overview
Product Specifications
| Description | Elicits platelet aggregation by the binding to the C-type lectin domain family 1 member B (CLEC1B/CLEC2). Binding leads to tyrosine phosphorylation in the Cytoplasmic domain tail of CLEC1B, which promotes the binding of spleen tyrosine kinase (Syk), subsequent activation of PLCgamma2, and platelet activation and aggregation. Binding to GPIbalpha (GP1BA) and alpha2/beta-1 (ITGA2/ITGB1) may also induce aggregation, but this is controversial. Source: Recombinant protein corresponding to aa24-146 from calloselasma rhodostoma Snaclec rhodocytin subunit beta, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~16.4kD AA Sequence: DCPSGWSSYEGHCYKPFNEPKNWADAERFCKLQPKHSHLVSFQSAEEADFVVKLTRPRLKANLVWMGLSNIWHGCNWQWSDGARLNYKDWQEQSECLAFRGVHTEWLNMDCSSTCSFVCKFKA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. |
| Purity | ~90% (SDS-PAGE) |
| Form | Supplied as a liquid in Tris, 50% glycerol. |
Product Properties
| Source Antigen | Recombinant, Yeast |
| Grade | Highly Purified |
| Molecular Weight | 16.4 |
| Storage Instructions | -20°C |
| Reactivity Life | 6 months |
Target Gene
NA
