SPA17, Recombinant, Human, aa1-146, GST-Tag (Sperm Surface Protein Sp17)
Price range: $ 499.83 through $ 895.13
For reserch purpose only
Catalog No
USB-375377
Supplier
US Biologicals
Size
1 mg > 10 µg
Product Overview
Product Properties
Target Gene
Product Overview
Product Specifications
| Description | Sperm surface zona pellucida binding protein. Helps to bind spermatozoa to the zona pellucida with high affinity. Might function in binding zona pellucida and carbohydrates. Recombinant protein corresponding to aa1-146 from human SPA17, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~43.8kD Amino Acid Sequence: MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDPAEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVKIQAAFRGHIAREEAKKMKTNSLQNEE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. |
| Purity | ~90% (SDS-PAGE) |
| Form | Supplied as a liquid in 10mM Tris-HCl, 1mM EDTA and 50% glycerol. |
Product Properties
| Source Antigen | Recombinant, E. coli |
| Grade | Purified |
| Molecular Weight | 43.8 |
| Storage Instructions | -20°C |
| Reactivity Life | 6 months |
Target Gene
NA
