SPAG16, Recombinant, Human, aa1-183, GST-Tag (Sperm-associated Antigen 16 Protein)
Price range: $ 549.41 through $ 1,222.09
For reserch purpose only
Catalog No
USB-375378
Supplier
US Biologicals
Size
1 mg > 10 µg
Product Overview
Product Properties
Target Gene
Product Overview
Product Specifications
| Description | Necessary for sperm flagellar function. Plays a role in motile ciliogenesis. May help to recruit STK36 to the cilium or apical surface of the cell to initiate subsequent steps of construction of the central pair apparatus of motile cilia. Source: Recombinant protein corresponding to aa1-183 from human SPAG16, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~47.6kD AA Sequence: MAAQRGMPSSAVRVLEEALGMGLTAAGDARDTADAVAAEGAYYLEQVTITEASEDDYEYEEIPDDNFSIPEGEEDLAKAIQMAQEQATDTEILERKTVLPSKHAVPEVIEDFLCNFLIKMGMTRTLDCFQSEWYELIQKGVTELRTVGNVPDVYTQIMLLENENKNLKKDLKHYKQAAEYVIF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. |
| Purity | ~90% (SDS-PAGE) |
| Form | Supplied as a liquid in Tris, 50% glycerol. |
Product Properties
| Source Antigen | Recombinant, E. coli |
| Grade | Highly Purified |
| Molecular Weight | 47.6 |
| Storage Instructions | -20°C |
| Reactivity Life | 6 months |
Target Gene
NA
