SsaA1, Recombinant, Staphylococcus Aureus, aa27-255, His-Tag (Staphylococcal Secretory Antigen SsaA1)
$ 615.06 – $ 1,492.77Price range: $ 615.06 through $ 1,492.77
For reserch purpose only
Catalog No
USB-375416
Supplier
US Biologicals
Size
1 mg > 10 µg
Product Overview
Product Properties
Target Gene
Product Overview
Product Specifications
| Description | Not known; immunogenic protein. Source: Recombinant protein corresponding to aa27-255 from staphylococcus aureus ssaA1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~27.0kD AA Sequence: AEQNNNGYNSNDAQSYSYTYTIDAQGNYHYTWTGNWNPSQLTQNNTYYYNNYNTYSYNNASYNNYYNHSYQYNNYTNNSQTATNNYYTGGSGASYSTTSNNVHVTTTAAPSSNGRSISNGYASGSNLYTSGQCTYYVFDRVGGKIGSTWGNASNWANAAASSGYTVNNTPKVGAIMQTTQGYYGHVAYVEGVNSNGSVRVSEMNYGHGAGVVTSRTISANQAGSYNFIH Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. |
| Purity | ~90% (SDS-PAGE) |
| Form | Supplied as a liquid in Tris, 50% glycerol. |
Product Properties
| Source Antigen | Recombinant, Yeast |
| Grade | Highly Purified |
| Molecular Weight | 27 |
| Storage Instructions | -20°C |
| Reactivity Life | 6 months |
Target Gene
NA

