TANK, Recombinant, Human, aa1-119, GST-Tag (TRAF Family Member-associated NF-kappa-B Activator)
Price range: $ 499.83 through $ 1,027.78
For reserch purpose only
Catalog No
USB-375491
Supplier
US Biologicals
Size
1 mg > 10 µg
Product Overview
Product Properties
Target Gene
Product Overview
Product Specifications
| Description | Adapter protein involved in I-kappa-B-kinase (IKK) regulation which constitutively binds TBK1 and IKBKE playing a role in antiviral innate immunity. Acts as a regulator of TRAF function by maintaining them in a latent state. Blocks TRAF2 binding to LMP1 and inhibits LMP1-mediated NF-kappa-B activation. May control negatively TRAF2-mediated NF-kappa-B activation signaled by CD40, TNFR1 and TNFR2. Source: Recombinant protein corresponding to aa1-119 from human TANK, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~40.8kD AA Sequence: MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQLSLQQTIIDKLKSQLLLVNSTQDNNYGCVPLLEDSETRKNNLTLDQPQDKVISGIAREKLPKVRRQEVSSPR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. |
| Purity | ~90% (SDS-PAGE) |
| Form | Supplied as a liquid in Tris, 50% glycerol. |
Product Properties
| Source Antigen | Recombinant, E. coli |
| Grade | Highly Purified |
| Molecular Weight | 40.8 |
| Storage Instructions | -20°C |
| Reactivity Life | 6 months |
Target Gene
NA
