TNFAIP8, Recombinant, Human, aa2-198, GST-Tag (Tumor Necrosis Factor alpha-induced Protein 8)
Price range: $ 499.83 through $ 1,027.78
For reserch purpose only
Catalog No
USB-375620
Supplier
US Biologicals
Size
1 mg > 10 µg
Product Overview
Product Properties
Target Gene
Product Overview
Product Specifications
| Description | Acts as a negative mediator of apoptosis and may play a role in tumor progression. Suppresses the TNF-mediated apoptosis by inhibiting caspase-8 activity but not the processing of procaspase-8, subsequently resulting in inhibition of BID cleavage and caspase-3 activation. Source: Recombinant protein corresponding to aa2-198 from human TNFAIP8, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~49.9kD AA Sequence: HSEAEESKEVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEKIIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDYTFDRNVLSRLLNECREMLHQIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. |
| Purity | ~90% (SDS-PAGE) |
| Form | Supplied as a liquid in Tris, 50% glycerol. |
Product Properties
| Source Antigen | Recombinant, E. coli |
| Grade | Highly Purified |
| Molecular Weight | 49.9 |
| Storage Instructions | -20°C |
| Reactivity Life | 6 months |
Target Gene
NA
