TRMT112, Recombinant, Human, aa1-125, His-SUMO-Tag (tRNA Methyltransferase 112 Homolog)
Price range: $ 499.83 through $ 895.13
For reserch purpose only
Catalog No
USB-375683
Supplier
US Biologicals
Size
1 mg > 10 µg
Product Overview
Product Properties
Target Gene
Product Overview
Product Specifications
| Description | Participates both in methylation of protein and tRNA species. The heterodimer with HK2/N6AMT1 catalyzes N5-methylation of ETF1 on ‘Gln-185’, using S-adenosyl L-methionine as methyl donor. The heterodimer with ALKBH8 catalyzes the methylation of 5-carboxymethyl uridine to 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in target tRNA species. Source: Recombinant protein corresponding to aa1-125 from human TRMT112, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~30.2kD AA Sequence: MKLLTHNLLSSHVRGVGSRGFPLRLQATEVRICPVEFNPNFVARMIPKVEWSAFLEAADNLRLIQVPKGPVEGYEENEEFLRTMHHLLLEVEVIEGTLQCPESGRMFPISRGIPNMLLSEEETES Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. |
| Purity | ~90% (SDS-PAGE) |
| Form | Supplied as a liquid in Tris, 50% glycerol. |
Product Properties
| Source Antigen | Recombinant, E. coli |
| Grade | Purified |
| Molecular Weight | 30.2 |
| Storage Instructions | -20°C |
| Reactivity Life | 6 months |
Target Gene
NA
