Uncharacterized Protein KIAA1377, Recombinant, Human, aa559-670, His-SUMO-Tag (KIAA1377)
$ 519.92 – $ 1,104.16Price range: $ 519.92 through $ 1,104.16
For reserch purpose only
Catalog No
USB-375780
Supplier
US Biologicals
Size
1 mg > 10 µg
Product Overview
Product Properties
Target Gene
Product Overview
Product Specifications
| Description | Participates in cytokinesis. Necessary for microtubules and mitotic spindle organization. Involved in primary cilium formation. Source: Recombinant protein corresponding to aa559-670 from human KIAA1377, fused to His-SUMO-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~28.9kD AA Sequence: HKKMKYNIHERNGVRFLKSILKKESKYEHGYLKALIINQSFKFGNQKAAAIRDSIELTKEKGAEIPKTIKKLRWFDETSNIENNAENSHSLKNKTGTTQQHSQQFHIQSGAG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. |
| Purity | ~90% (SDS-PAGE) |
| Form | Supplied as a liquid in Tris, 50% glycerol. |
Product Properties
| Source Antigen | Recombinant, Yeast |
| Grade | Highly Purified |
| Molecular Weight | 28.9 |
| Storage Instructions | -20°C |
| Reactivity Life | 6 months |
Target Gene
NA

