VACWR034, Recombinant, Vaccinia Virus, aa1-88, His-Tag (Protein K3)
Price range: $ 615.06 through $ 1,425.76
For reserch purpose only
Catalog No
USB-375803
Supplier
US Biologicals
Size
1 mg > 10 µg
Product Overview
Product Properties
Target Gene
Product Overview
Product Specifications
| Description | Viral mimic of eIF-2-alpha that acts as a pseudosubstrate for EIF2AK2/PKR kinase. Inhibits therefore eIF-2-alpha phosphorylation by host EIF2AK2/PKR kinase and prevents protein synthesis shutoff. Source: Recombinant protein corresponding to aa1-88 from vaccinia virus Protein K3, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~12.6kD AA Sequence: MLAFCYSLPNAGDVIKGRVYEKDYALYIYLFDYPHFEAILAESVKMHMDRYVEYRDKLVGKTVKVKVIRVDYTKGYIDVNYKRMCRHQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. |
| Purity | ~90% (SDS-PAGE) |
| Form | Supplied as a liquid in Tris, 50% glycerol. |
Product Properties
| Source Antigen | Recombinant, Yeast |
| Grade | Purified |
| Molecular Weight | 12.6 |
| Storage Instructions | -20°C |
| Reactivity Life | 6 months |
Target Gene
NA
