VASH2, Recombinant, Human, aa1-355, His-SUMO-Tag (Vasohibin-2)
Price range: $ 549.41 through $ 1,222.09
For reserch purpose only
Catalog No
USB-375806
Supplier
US Biologicals
Size
1 mg > 10 µg
Product Overview
Product Properties
Target Gene
Product Overview
Product Specifications
| Description | Angiogenesis inhibitor. Inhibits network formation by endothelial cells. Source: Recombinant protein corresponding to aa1-355 from human VASH2, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~56.4kD AA Sequence: MTGSAADTHRCPHPKGAKGTRSRSSHARPVSLATSGGSEEEDKDGGVLFHVNKSGFPIDSHTWERMWMHVAKVHPKGGEMVGAIRNAAFLAKPSIPQVPNYRLSMTIPDWLQAIQNYMKTLQYNHTGTQFFEIRKMRPLSGLMETAKEMTRESLPIKCLEAVILGIYLTNGQPSIERFPISFKTYFSGNYFHHVVLGIYCNGRYGSLGMSRRAELMDKPLTFRTLSDLIFDFEDSYKKYLHTVKKVKIGLYVPHEPHSFQPIEWKQLVLNVSKMLRADIRKELEKYARDMRMKILKPASAHSPTQVRSRGKSLSPRRRQASPPRRLGRREKSPALPEKKVADLSTLNEVGYQIRI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. |
| Purity | ~90% (SDS-PAGE) |
| Form | Supplied as a liquid in Tris, 50% glycerol. |
Product Properties
| Source Antigen | Recombinant, E. coli |
| Grade | Highly Purified |
| Molecular Weight | 56.4 |
| Storage Instructions | -20°C |
| Reactivity Life | 6 months |
Target Gene
NA
