ATAD2B, Recombinant, Human, aa953-1080, His-Tag (KIAA1240, AAA Domain Containing 2B, Variant 1)
657.38 $
For reserch purpose only
Shipping cost plus VAT not included , delivery in 7-14 business days
Catalog No
USB-298329
Supplier
US Biologicals
Size
100 µg
Product Overview
Product Properties
Target Gene
Product Overview
| Description | The protein encoded by this gene belongs to the AAA ATPase family. This family member includes an N-terminal bromodomain. It has been found to be localized to the nucleus, partly to replication sites, consistent with a chromatin-related function. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jul 2014] Source: Recombinant protein corresponding to aa953-1080 from bromodomain human ATAD2B, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~15.9kD AA Sequence: MHHHHHHEDQEENTLRELRLFLRDVTKRLATDKRFNIFSKPVDIEEVSDYLEVIKEPM DLSTVITKIDKHNYLTAKDFLKDIDLICSNALEYNPDKDPGDKIIRHRACTLKDTAHAIIA AELDPEFNKLCEEIKE Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. |
| Source Antigen | Recombinant, E. coli |
| Reactivity | |
| Cross Reactivity | |
| Applications | |
| Molecular Weight | 15.9 |
Product Properties
| Storage | -70°C |
| Grade | Highly Purified |
| Purity | Highly Purified (~99%) |
| Form | Supplied as a liquid in 50mM Tris-HCl, pH 8.0, 138mM sodium chloride, 2.7mM potassium chloride, 10% glycerol. |
| Reactivity Life | 12 months |
| Note | For reserch purpose only |
Target Gene
NA
