Brain Natriuretic Peptide (BNP), Recombinant, Human
533.52 $
For reserch purpose only
Shipping cost plus VAT not included , delivery in 7-14 business days
Catalog No
USB-359894
Supplier
US Biologicals
Size
20 µg
Product Overview
Product Properties
Target Gene
Product Overview
| Description | Source: Recombinant protein corresponding to human Brain Natriuretic Peptide (BNP), a single non-glycosylated polypeptide chain containing 32aa, expressed in E. coli. Molecular Weight: ~3.5kD (32aa) Applications: Suitable for use in SDS-PAGE. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Endotoxin: <1EU/mg (LAL) AA Sequence: SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH Storage and Stability: Lyophilized powder may be stored at -20°C. Reconstitute with sterile dH2O, 0.1% BSA. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. |
| Source Antigen | Recombinant, E. coli |
| Reactivity | |
| Cross Reactivity | |
| Applications | |
| Molecular Weight | 3.5 |
Product Properties
| Storage | -20°C |
| Grade | Highly Purified |
| Purity | ~97% (SDS-PAGE, HPLC) |
| Form | Supplied as a lyophilized powder in PBS, pH 7.4. Reconstitute with sterile dH2O, 0.1% BSA to 0.1-1mg/ml. |
| Reactivity Life | 6 months |
| Note | For reserch purpose only |
Target Gene
NA
