BTLA, Recombinant, Human (CD272)
669.80 $
For reserch purpose only
Shipping cost plus VAT not included , delivery in 7-14 business days
Catalog No
USB-172318
Supplier
US Biologicals
Size
100 µg
Product Overview
Product Properties
Target Gene
Product Overview
| Description | Lymphocyte inhibitory receptor which inhibits lymphocytes during immune response. Source: Recombinant protein corresponding to aa31-150 from human STLA expressed in HEK293 cell expression system Molecular Weight: ~40.3kD AA Sequence: KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTS WKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDE MASIEGRMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKV SNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWES NGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKS LSLSPGK Applications: Suitable for use in the study of enzyme kinetics, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. Aliquots are stable for 6 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. |
| Source Antigen | Recombinant |
| Reactivity | |
| Cross Reactivity | |
| Applications | |
| Molecular Weight | 40.3 |
Product Properties
| Storage | -70°C |
| Grade | Highly Purified |
| Purity | ~90% |
| Form | Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM NaCl, 2.2mM KCl, 20% glycerol |
| Reactivity Life | 12 months |
| Note | For reserch purpose only |
Target Gene
NA
