C1QA, Recombinant, Mouse, aa23-245, His-Tag (Complement C1q Subcomponent Subunit A)
524.64 $
For reserch purpose only
Shipping cost plus VAT not included , delivery in 7-14 business days
Catalog No
USB-372514
Supplier
US Biologicals
Size
10 µg
Product Overview
Product Properties
Target Gene
Product Overview
| Description | C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complent system. The collagen-like regions of C1q interact with the Ca2+-dependent C1r2C1s2 proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes. Source: Recombinant protein corresponding to aa23-245 from mouse C1QA, fused to 6xHis-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~25.5kD AA Sequence: EDVCRAPNGKDGAPGNPGRPGRPGLKGERGEPGAAGIRTGIRGFKGDPGESGPPGKPGNVGLPGPSGPLGDSGPQGLKGVKGNPGNIRDQPRPAFSAIRQNPMTLGNVVIFDKVLTNQESPYQNHTGRFICAVPGFYYFNFQVISKWDLCLFIKSSSGGQPRDSLSFSNTNNKGLFQVLAGGTVLQLRRGDEVWIEKDPAKGRIYQGTEADSIFSGFLIFPSA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. |
| Source Antigen | Recombinant, Yeast |
| Reactivity | |
| Cross Reactivity | |
| Applications | |
| Molecular Weight | 25.5 |
Product Properties
| Storage | -20°C |
| Grade | Purified |
| Purity | ~90% (SDS-PAGE) |
| Form | Supplied as a liquid in Tris, 50% glycerol. |
| Reactivity Life | 6 months |
| Note | For reserch purpose only |
Target Gene
NA
