CBX7, Recombinant, Human, aa2-90, GST-tag (Chromobox Homolog 7)
780.88 $
For reserch purpose only
Shipping cost plus VAT not included , delivery in 7-14 business days
Catalog No
USB-298388
Supplier
US Biologicals
Size
100 µg
Product Overview
Product Properties
Target Gene
Product Overview
| Description | Source: Recombinant protein corresponding to aa2-90 from human CBX7, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~11.6kD AA Sequence: MHHHHHHELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDP RLVMAYEEKEERDRASGYRKRGPKPKRLLLQRLYSMDLR Applications: Suitable for use in protein binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. |
| Source Antigen | Recombinant, E. coli |
| Reactivity | |
| Cross Reactivity | |
| Applications | |
| Molecular Weight | 11.6 |
Product Properties
| Storage | -70°C |
| Grade | Highly Purified |
| Purity | Highly Purified (~90%) |
| Form | Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM sodium chloride, 2.2mM potassium chloride, 0.04% Tween 20, 20% glycerol. |
| Reactivity Life | 12 months |
| Note | For reserch purpose only |
Target Gene
NA
