CD160, Recombinant, Human, aa27-159, His-Tag
419.38 $
For reserch purpose only
Shipping cost plus VAT not included , delivery in 7-14 business days
Catalog No
USB-516797
Supplier
US Biologicals
Size
10 µg
Product Overview
Product Properties
Target Gene
Product Overview
| Description | Receptor showing broad specificity for both classical and non-classical MHC class I molecules. Source: Recombinant full length protein corresponding to aa27-159 of human CD160, fused to His-Tag at C-terminal, expressed in mammalian cell. Molecular Weight: ~15.8kD Biological Activity: The ED50 as determined by its ability to bind Mouse TNFRSF14 in functional ELISA is less than 50ug/ml. Endotoxin: <1EU/ug (LAL). AA Sequence: INITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLS Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 12 months after receipt at -20°C. Reconstitute with sterile buffer or ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. |
| Source Antigen | Recombinant, Mammalian cell |
| Reactivity | |
| Cross Reactivity | |
| Applications | |
| Molecular Weight | 15.8 |
Product Properties
| Storage | -20°C |
| Grade | Purified |
| Purity | ≥90% (SDS-PAGE) |
| Form | Supplied as a lyophilized powder in 20mM PBS, pH 7.4. |
| Reactivity Life | |
| Note | For reserch purpose only |
Target Gene
NA
