CD63 Antigen, Recombinant, Human, aa103-203, His-Tag (CD63)
559.11 $
For reserch purpose only
Shipping cost plus VAT not included , delivery in 7-14 business days
Catalog No
USB-517840
Supplier
US Biologicals
Size
10 µg
Product Overview
Product Properties
Target Gene
Product Overview
| Description | Functions as cell surface receptor for TIMP1 and plays a role in the activation of cellular signaling cascades. Plays a role in the activation of ITGB1 and integrin signaling, leading to the activation of AKT, FAK/PTK2 and MAP kinases. Promotes cell survival, reorganization of the actin cytoskeleton, cell adhesion, spreading and migration, via its role in the activation of AKT and FAK/PTK2. Plays a role in VEGFA signaling via its role in regulating the internalization of KDR/VEGFR2. Plays a role in intracellular vesicular transport processes, and is required for normal trafficking of the PMEL luminal domain that is essential for the development and maturation of melanocytes. Plays a role in the adhesion of leukocytes onto endothelial cells via its role in the regulation of SELP trafficking. May play a role in mast cell degranulation in response to Ms4a2/FceRI stimulation, but not in mast cell degranulation in response to other stimuli. Source: Partial recombinant protein corresponding to aa103-203 of human CD63 Antigen, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~13.5kD AA Sequence: AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. |
| Source Antigen | Recombinant, Yeast |
| Reactivity | |
| Cross Reactivity | |
| Applications | |
| Molecular Weight | 13.5 |
Product Properties
| Storage | -20°C |
| Grade | Purified |
| Purity | ~85% (SDS-PAGE) |
| Form | Supplied as a liquid in Tris-based buffer, 50% glycerol. |
| Reactivity Life | |
| Note | For reserch purpose only |
Target Gene
NA
