Complement Factor D, Recombinant, Rat, aa26-263, His-Tag, Myc-Tag (Cfd)
575.95 $
For reserch purpose only
Shipping cost plus VAT not included , delivery in 7-14 business days
Catalog No
USB-405896
Supplier
US Biologicals
Size
10 µg
Product Overview
Product Properties
Target Gene
Product Overview
| Description | Factor D cleaves factor B when the latter is complexed with factor C3b, activating the C3bbb complex, which then becomes the C3 convertase of the alternate pathway. Its function is homologous to that of C1s in the classical pathway. Source: Recombinant protein corresponding to aa26-263 from rat Complement factor D, fused to His-Tag at N-terminal and fused to Myc-Tag at C-terminal, expressed in mammalian cell. Molecular Weight: ~29.8kD AA Sequence: ILGGQEAMAHARPYMASVQVNGTHVCGGTLVDEQWVLSAAHCMDGVTKDEVVQVLLGAHSLSSPEPYKHLYDVQSVVLHPGSRPDSVEDDLMLFKLSHNASLGPHVRPLPLQREDREVKPGTLCDVAGWGVVTHAGRRPDVLQQLTVSIMDRNTCNLRTYHDGAITKNMMCAESNRRDTCRGDSGGPLVCGDAVEAVVTWGSRVCGNRRKPGVFTRVATYVPWIENVLSGNVSVNVTA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. |
| Source Antigen | Recombinant, Mammalian cell |
| Reactivity | |
| Cross Reactivity | |
| Applications | |
| Molecular Weight | 29.8 |
Product Properties
| Storage | -20°C |
| Grade | Purified |
| Purity | ~90% (SDS-PAGE) |
| Form | Supplied as a liquid in Tris, 50% glycerol. |
| Reactivity Life | 6 months |
| Note | For reserch purpose only |
Target Gene
NA
