Elongation Factor P, Recombinant, E. coli, aa2-188, His-Tag (Efp)
590.09 $
For reserch purpose only
Shipping cost plus VAT not included , delivery in 7-14 business days
Catalog No
USB-373173
Supplier
US Biologicals
Size
10 µg
Product Overview
Product Properties
Target Gene
Product Overview
| Description | Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Beta-lysylation at Lys-34 is required for alleviation. The Pro codons and their context do not affect activity; only consecutive Pro residues (not another amino acid) are affected by EF-P. Has stimulatory effects on peptide bond formation between ribosome-bound initiator tRNA(fMet) and puromycin, and N-acetyl-Phe tRNA(Phe)-primed poly(U)-directed poly(Phe) synthesis. Source: Recombinant protein corresponding to aa2-188 from E. coli Elongation Factor P, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~22.5kD AA Sequence: ATYYSNDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNLTYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQIGEVIKVDTRSGEYVSRVK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. |
| Source Antigen | Recombinant, Yeast |
| Reactivity | |
| Cross Reactivity | |
| Applications | |
| Molecular Weight | 22.5 |
Product Properties
| Storage | -20°C |
| Grade | Highly Purified |
| Purity | ~90% (SDS-PAGE) |
| Form | Supplied as a liquid in Tris, 50% glycerol. |
| Reactivity Life | 6 months |
| Note | For reserch purpose only |
Target Gene
NA
