F420-Dependent NADP Reductase, Recombinant, Methanothermobacter Marburgensis, aa1-224, His-Tag, Myc-Tag (Fno)
587.91 $
For reserch purpose only
Shipping cost plus VAT not included , delivery in 7-14 business days
Catalog No
USB-517899
Supplier
US Biologicals
Size
10 µg
Product Overview
Product Properties
Target Gene
Product Overview
| Description | Catalyzes the reduction of NADP+ with F420H2 via hydride transfer, and the reverse reaction, i.e. the reduction of F420 with NADPH. Probably functions in the regeneration of NADPH required in biosynthetic reactions. Source: Recombinant full length protein corresponding to aa1-224 of Methanothermobacter Marburgensis F420-Dependent NADP Reductase, fused to 10xHis-Tag at N-terminal and Myc-Tag at C-terminal, expressed in Baculovirus. Molecular Weight: ~27.4kD AA Sequence: MKIAVLGGTGDQGLGLALRLALAGEEVIIGSRDAEKAVSAAQKVLEIAERDDLKVKGATNAEAAEEAEVAILTVPLQAQMATLGSVKEAIKGKVLIDATVPIDSCLGGSAVRYIDLWDGSAAERAARFLEDQGTRVAAAFNNISASALLDITGPVDCDCLIASDHRDALDLASELAEKIDGVRAIDCGGLENARVIEKITPLLINLNIKNRIRNAGIRITNLPE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. |
| Source Antigen | Recombinant, Baculovirus |
| Reactivity | |
| Cross Reactivity | |
| Applications | |
| Molecular Weight | 27.4 |
Product Properties
| Storage | -20°C |
| Grade | Purified |
| Purity | ~85% (SDS-PAGE) |
| Form | Supplied as a liquid in Tris-based buffer, 50% glycerol. |
| Reactivity Life | |
| Note | For reserch purpose only |
Target Gene
NA
