Fibrinogen Beta (FGb) Recombinant, Rat
453.82 $
For reserch purpose only
Shipping cost plus VAT not included , delivery in 7-14 business days
Catalog No
USB-154565
Supplier
US Biologicals
Size
10 µg
Product Overview
Product Properties
Target Gene
Product Overview
| Description | Source: Recombinant Rat from E. coli Purity: ≥95% Endotoxin: 1.0EU per 1ug (determined by the LAL method) Accession No: Fragment: Gly33~Gln479 (Accession No: ) Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-GHRPVDRR KEEPPSLRPA PPPISGGGYR ARPAKVDAGQ KKVERKPPDA GGCVHGDGDM GVLCPTGCEL RQTLLNHERP IKNSIAELNS NINSVSETSS VTFQYLTLLK DMWKKKQAQV KDNENVINEY SSILEDQKLY IDETVNDNIP LNLRVLRSIL EDLRSKIQKL ESDISAQTEY CHTPCTVNCN IPVVSGKECE EIIRKGGETS EMYLIQPDTS SKPYRVYCDM KTENGGWTVI QNRQDGSVDF GRKWDPYKKG FGNIATNEDT KKYCGLPGEY WLGNDKISQL TRIGPTELLI EMEDWKGDKV KAHYGGFTVQ TEANKYQVSV NKYKGTAGNA LMEGASQLVG ENRTMTIHNG MFFSTYDRDN DGWVTTDPRK QCSKEDGGGW WYNRCHAANP NGRYYWGGLY SWDMSKHGTD DGVVWMNWKG SWYSMRRMSM KIRPVFPQQ Epitope Tag: N-terminal Tags: His-tag and S-tag Molecular Weight: 56.4kD Applications: Suitable for use in ELISA, Western Blot, Immunoprecipitation, SDS-PAGE. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -80°C. Aliquots are stable for at least 12 months from date of shipment. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Thermal stability is described by the loss rate of the target protein. The loss rate was determined by accelerated thermal degradation by incubating the protein at 37°C for 48h, with no obvious degradation or precipitation observed. Protein loss is <5% within the expiration date under appropriate storage conditions. |
| Source Antigen | Recombinant Rat from E. coli |
| Reactivity | |
| Cross Reactivity | |
| Applications | |
| Molecular Weight | 56.4 |
Product Properties
| Storage | 4°C/-70°C |
| Grade | Highly Purified |
| Purity | ≥95% |
| Form | Supplied as lyophilized powder in PBS, pH7.4, 5% sucrose, 0.01% sarcosyl. Reconstitute in sterile PBS, pH7.2. |
| Reactivity Life | 12 months |
| Note | For reserch purpose only |
Target Gene
NA
