Glucagon-Like Peptide 2 (GLP-2)
551.52 $
For reserch purpose only
Shipping cost plus VAT not included , delivery in 7-14 business days
Catalog No
USB-214856
Supplier
US Biologicals
Size
1 mg
Product Overview
Product Properties
Target Gene
Product Overview
| Description | Glucagon-like peptide 2, a cleavage product of Glucagon. Glucagon-like peptide 2 plays a key role in nutrient homeostatis and stimulates intestinal growth and glucose transport. Source: Human Glucagon-Like Peptide 2 Sequence: HADGSFSDEMNTILDNLAARDFINWLIQTKITD Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. |
| Source Antigen | Synthetic |
| Reactivity | |
| Cross Reactivity | Human |
| Applications | |
| Molecular Weight |
Product Properties
| Storage | -20°C |
| Grade | Highly Purified |
| Purity | ~90% (HPLC) |
| Form | Supplied as a lyophilized powder. Reconstitute with 1ml ddH2O. |
| Reactivity Life | 12 months |
| Note | For reserch purpose only |
Target Gene
NA
