NOGGIN, Recombinant, Mouse (Nog)
533.52 $
For reserch purpose only
Shipping cost plus VAT not included , delivery in 7-14 business days
Catalog No
USB-360887
Supplier
US Biologicals
Size
5 µg
Product Overview
Product Properties
Target Gene
Product Overview
| Description | Noggin is a secreted polypeptide, originally identified as an antagonist of BMP-4, which binds to and inactivates signal transduction by members of the transforming growth factor-beta (TGF-beta) superfamily, and plays an essential role in cartilage morphogenesis, joint formation and neural tube fusion, as determined by mouse knockout studies. Noggin is implicated in both early and later developmental stages, and can be used as a tool to differentiate human embryonic stem cells into neural precursor cells. Source: Recombinant protein corresponding to mouse NOGGIN, a disulfide-linked homodimer consisting of two 206aa polypeptide chains, expressed in E. coli. Molecular Weight: ~46.4kD (206aa) Applications: Suitable for use in SDS-PAGE. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Biological Activity: Determined by its ability to inhibit 5ng/ml of BMP-4 induced alkaline phosphatase production by ATDC chondrogenic cells. The expected ED50 for this effect is 1-2ng/ml of Noggin, corresponding to a specific activity of ＞5x10e5IU/mg. Endotoxin: <1EU/mg (LAL) AA Sequence: QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSV PEGMVCKPSK SVHLTVLRWR CQRRGGQRCG WIPIQYPIIS ECKCSC Storage and Stability: Lyophilized powder may be stored at -20°C. Reconstitute with 10mM HAc. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. |
| Source Antigen | Recombinant, E. coli |
| Reactivity | |
| Cross Reactivity | |
| Applications | |
| Molecular Weight | 46.4 |
Product Properties
| Storage | -20°C |
| Grade | Highly Purified |
| Purity | ~95% (SDS-PAGE, HPLC) |
| Form | Supplied as a lyophilized powder in 30% acetonitrile, 0.1% TFA. Reconstitute with sterile 10mM HAc to 0.1-1mg/ml. |
| Reactivity Life | 6 months |
| Note | For reserch purpose only |
Target Gene
NA
