Odorant-Binding Protein, Recombinant, Bovine, aa1-159
631.03 $
For reserch purpose only
Shipping cost plus VAT not included , delivery in 7-14 business days
Catalog No
USB-518028
Supplier
US Biologicals
Size
10 µg
Product Overview
Product Properties
Target Gene
Product Overview
| Description | This protein binds a wide variety of chemical odorants. Source: Recombinant full length protein corresponding to aa1-159 of bovine Odorant-Binding Protein, expressed in E. coli. Molecular Weight: ~18.5kD AA Sequence: AQEEEAEQNLSELSGPWRTVYIGSTNPEKIQENGPFRTYFRELVFDDEKGTVDFYFSVKRDGKWKNVHVKATKQDDGTYVADYEGQNVFKIVSLSRTHLVAHNINVDKHGQTTELTELFVKLNVEDEDLEKFWKLTEDKGIDKKNVVNFLENEDHPHPE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. |
| Source Antigen | Recombinant, E. coli |
| Reactivity | |
| Cross Reactivity | |
| Applications | |
| Molecular Weight | 18.5 |
Product Properties
| Storage | -20°C |
| Grade | Purified |
| Purity | ~85% (SDS-PAGE) |
| Form | Supplied as a liquid in Tris-based buffer, 50% glycerol. |
| Reactivity Life | |
| Note | For reserch purpose only |
Target Gene
NA
