Parathyroid Hormone, Human, aa1-34 (PTH)
490.66 $
For reserch purpose only
Shipping cost plus VAT not included , delivery in 7-14 business days
Catalog No
USB-298232
Supplier
US Biologicals
Size
100 µg
Product Overview
Product Properties
Target Gene
Product Overview
| Description | The protein encoded by this gene is a hormone secreted by parathyroid cells. This hormone elevates blood Ca2+ level by dissolving the salts in bone and preventing their renal excretion. Defects in this gene are a cause of familial isolated hypoparathyroidism (FIH). [provided by RefSeq, Jul 2008] Source: Synthetic human Parathyroid Hormone AA Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 12 months after receipt at -20°C. Reconstitute with sterile buffer. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. |
| Source Antigen | Synthetic |
| Reactivity | |
| Cross Reactivity | |
| Applications | |
| Molecular Weight |
Product Properties
| Storage | -20°C |
| Grade | Highly Purified |
| Purity | ~95% (HPLC) |
| Form | Supplied as a lyophilized powder. Reconstitute with 0.1% acetic acid. |
| Reactivity Life | 12 months |
| Note | For reserch purpose only |
Target Gene
NA
