PD-1, Recombinant, Human (Programmed Cell Death 1, PDCD1, PD-1, PD1, SLEB2, CD279, HPD-L) (Biotin) discontinued
748.72 $
For reserch purpose only
Shipping cost plus VAT not included , delivery in 7-14 business days
Catalog No
USB-172348
Supplier
US Biologicals
Size
50 µg
Product Overview
Product Properties
Target Gene
Product Overview
| Description | Inhibitory cell surface receptor involved in the regulation of T-cell function during immunity and tolerance. Upon ligand binding, inhibits T-cell effector functions in an antigen-specific manner. Possible cell death inducer, in association with other factors. Source: Recombinant protein corresponding to aa25-167 from human PCSK9, fused to C-terminal FLAG and Avi tags, expressed in a HEK293 cell expression system. Molecular Weight: ~44.5kD AA Sequence: LDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAA FPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESL RAELRVTERRAEVPTAHPSPSPRPAGQFQIEGRMDPKSCDKTHTCPPCPAPELLGGP SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR EEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGGGLNDIFEAQKIEWHE Applications: Suitable for use in the study of enzyme kinetics, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. Aliquots are stable for 6 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. |
| Source Antigen | Recombinant |
| Reactivity | |
| Cross Reactivity | |
| Applications | |
| Molecular Weight | 44.5 |
Product Properties
| Storage | -70°C |
| Grade | Purified |
| Purity | ~59% |
| Form | Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM NaCl, 2.2mM KCl, 20% glycerol. Labeled with Biotin. |
| Reactivity Life | 12 months |
| Note | For reserch purpose only |
Target Gene
NA
