Platelet/Endothelial Cell Adhesion Molecule (PECAM1) Recombinant, Mouse
457.89 $
For reserch purpose only
Shipping cost plus VAT not included , delivery in 7-14 business days
Catalog No
USB-156387
Supplier
US Biologicals
Size
10 µg
Product Overview
Product Properties
Target Gene
Product Overview
| Description | Source: Recombinant Mouse from E. coli Purity: ≥95% Endotoxin: 1.0EU per 1ug (determined by the LAL method) Accession No: Q08481 Fragment: Arg78~Glu214 (Accession No: Q08481) Sequence: MGHHHHHHSGSEFELRRQAC-REHTESYVIP QARVFHSGKY KCTVMLNNKE KTTIEYEVKV HGVSKPKVTL DKKEVTEGGV VTVNCSLQEE KPPIFFKIEK LEVGTKFVKR RIDKTSNENF VLMEFPIEAQ DHVLVFRCQA GILSGFKLQE SEPIRSE Epitope Tag: N-terminal His-Tag Molecular Weight: 18.1kD Applications: Suitable for use in ELISA, Western Blot, Immunoprecipitation, SDS-PAGE. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -80°C. Aliquots are stable for at least 12 months from date of shipment. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Thermal stability is described by the loss rate of the target protein. The loss rate was determined by accelerated thermal degradation by incubating the protein at 37°C for 48h, with no obvious degradation or precipitation observed. Protein loss is <5% within the expiration date under appropriate storage conditions. |
| Source Antigen | Recombinant Mouse from E. coli |
| Reactivity | |
| Cross Reactivity | |
| Applications | |
| Molecular Weight | 18.1 |
Product Properties
| Storage | 4°C/-70°C |
| Grade | Highly Purified |
| Purity | ≥95% |
| Form | Supplied as lyophilized powder in PBS, pH7.4, 5% sucrose, 0.01% sarcosyl. Reconstitute in sterile PBS, pH7.2. |
| Reactivity Life | 12 months |
| Note | For reserch purpose only |
Target Gene
NA
