Pre-Pro-Atrial Natriuretic Peptide, Recombinant, Human, aa1-126 (Natriuretic Peptides A, CDD-ANF, Prepronatriodilatin)
645.81 $
For reserch purpose only
Shipping cost plus VAT not included , delivery in 7-14 business days
Catalog No
USB-298241
Supplier
US Biologicals
Size
20 µg
Product Overview
Product Properties
Target Gene
Product Overview
| Description | Hormone playing a key role in cardiovascular homeostasis through regulation of natriuresis, diuresis, and vasodilation. Also plays a role in female pregnancy by promoting trophoblast invasion and spiral artery remodeling in uterus. Specifically binds and stimulates the cGMP production of the NPR1 receptor. Binds the clearance receptor NPR3. Source: Recombinant protein corresponding to aa1-126 from human Pre-Pro-Atrial Natriuretic Peptide, expressed in E. coli. Molecular Weight: ~13.81kD AA Sequence: MNPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALSPL PEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLTAPRSLRRSSCFG GRMDRIGAQSGLGCNSFRY Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. |
| Source Antigen | Recombinant, E. coli |
| Reactivity | |
| Cross Reactivity | |
| Applications | |
| Molecular Weight | 13.81 |
Product Properties
| Storage | -20°C |
| Grade | Purified |
| Purity | ~70% (capillary gel electrophoresis) |
| Form | Supplied as a lyophilized powder. Reconstitute with sterile ddH2O. |
| Reactivity Life | 12 months |
| Note | For reserch purpose only |
Target Gene
NA
