TAF1L, Recombinant, Human, aa1517-1649, GST-tag (TAF1 RNA Polymerase II, TAT Box Binding Protein (TBP)-Associated Factor)
657.38 $
For reserch purpose only
Shipping cost plus VAT not included , delivery in 7-14 business days
Catalog No
USB-298478
Supplier
US Biologicals
Size
100 µg
Product Overview
Product Properties
Target Gene
Product Overview
| Description | This locus is intronless, and apparently arose in the primate lineage from retrotransposition of the transcript from the multi-exon TAF1 locus on the X chromosome. The gene is expressed in male germ cells, and the product has been shown to function interchangeably with the TAF1 product. [provided by RefSeq, Aug 2009]. Source: Recombinant protein corresponding to aa1517-1649 from human TAF1L, fused to GST-tag at N-terminal, expressed in E. coli. Molecular Weight: ~42.3kD AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYI DGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLK VDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLV CFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSLLDDD DQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKMIVNPVDLETIRKNISKHK YQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNICYQTITEYDEHLTQLEKDICTA KEAALEEAE Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. |
| Source Antigen | Recombinant, E. coli |
| Reactivity | |
| Cross Reactivity | |
| Applications | |
| Molecular Weight | 42.3 |
Product Properties
| Storage | -70°C |
| Grade | Highly Purified |
| Purity | Highly Purified (~99%) |
| Form | Supplied as a liquid in 45mM Tris-HCl, pH 8.0, 124mM sodium chloride, 2.4mM KCl, 10% glycerol. |
| Reactivity Life | 12 months |
| Note | For reserch purpose only |
Target Gene
NA
