TRAIL, Recombinant, Mouse (TNF-related apoptosis-inducing Ligand, TNFSF10, TL2)
396.23 $
For reserch purpose only
Shipping cost plus VAT not included , delivery in 7-14 business days
Catalog No
USB-143529
Supplier
US Biologicals
Size
10 µg
Product Overview
Product Properties
Target Gene
Product Overview
| Description | TRAIL is a cytotoxic protein, which activates rapid apoptosis in tumor cells, but not in normal cells.TRAIL induced apoptosis is achieved through binding to two death-signaling receptors, DR4 and DR5.These receptors belong to the TNFR superfamily of transmembrane proteins and contain a cytoplasmic death domainrdquo, which activates the cell’s apoptotic machinery.Recombinant murine TRAIL is a 174 amino acid polypeptide (20.0kD), consisting of the TNF homologous portion of the extracellular domain of the full length TRAIL protein. Biological Activity: Assay#1: Determined by the dose-dependent stimulation of MIP-2 production by mouse spleen cells using a concentration range of 10-100ng/ml. Assay#2:Measured by its ability to induce apoptosis in LN-18 cells (human glioblastoma cells). The expected ED50 for this effect is 40.0-60.0ng/ml. AA Sequence: MRGGRPQKVAAHITGITRRSNSALIPISKDGKTLGQKIESWESSRKGHSFLNHVLFRNGELVIEQEGLYYIYSQTYFRFQEAEDASKMVSKDKVRTKQLVQYIYKYTSYPDPIVLMKSARNSCWSRDAEYGLYSIYQGGLFELKKNDRIFVSVTNEHLMDLDQEASFFGAFLIN Crossreactivity: Human Quality Control: Verified by N-terminal and Mass Spectrometry analyses (when applicable). Endotoxin: <0.1ng/ug of protein (<1EU/ug). Protein Content: Verified by UV Spectroscopy and/or SDS-PAGE gel. Storage and Stability: Store lyophilized products at -20°C. For reconstituted solutions of most products, we recommend short-term storage at 4°C. For longer term storage the protein solution should be stored with a carrier protein (eg. 0.1% BSA) in working aliquots and stored frozen at -20°C. Additional freeze/thaw cycles may cause some denaturation of the protein. |
| Source Antigen | Recombinant, E. coli |
| Reactivity | |
| Cross Reactivity | |
| Applications | |
| Molecular Weight |
Product Properties
| Storage | -20°C |
| Grade | Highly Purified |
| Purity | ≥95% by SDS-PAGE gel and HPLC analyses. |
| Form | Supplied as a lyophilized powder. |
| Reactivity Life | 12 months |
| Note | For reserch purpose only |
Target Gene
NA
