UbcH1, Recombinant, Human (Huntingtin Interacting Protein 2, HIP2)
421.96 $
For reserch purpose only
Shipping cost plus VAT not included , delivery in 7-14 business days
Catalog No
USB-U0850-15
Supplier
US Biologicals
Size
10 µg
Product Overview
Product Properties
Target Gene
Product Overview
| Description | Among ubiquitin-conjugating enzymes, the mammalian ubiquitin conjugating enzyme UbcH1, also known as HIP2, is unique in its ability to catalyze the in vitro synthesis of unanchored Lys48-linked poly-ubiquitin chains from mono- or poly-ubiquitin, E1, and ATP. In addition, UbcH1 can catalyse the cyclization of longer poly-ubiquitin chains, including tetra- and penta-ubiquitin. Recombinant UbcH1 charges and supports ubiquitinylation in vitro. Typical enzyme concentration to support conjugation in vitro is 100nM to 1 M. Recently, HIP2 (or UbcH1) has been shown to bind to the N terminus of huntington and may play a role in Huntington disease. Recombinant Human UbcH1 also called HIP-2 produced in E.Coli is a non-glycosylated, Polypeptide chain containing 208 amino acids and having a molecular mass of 23.4kD. The human UbcH1 protein contains 6xHis tag and is purified by proprietary chromatographic techniques. Amino Acid Sequence: MHHHHHHAMANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPP DTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQ WAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQYKQNPEMFKQTARLWAHV YAGAPVSSPEYTKKIENLCAMGFDAVIVALSSKSWDVETATELLLSN. Endotoxin: ≤ 0.1ng/ug (IEU/ug) of recombinant human UbcH1. Solubility: It is recommended to reconstitute the lyophilized recombinant human HIP-2 in sterile water not less than 100µg/ml, which can then be further diluted to other aqueous solutions. Stability: Lyophilized recombinant HIP-2 although stable at room temperature for 3 weeks, should be stored desiccated below -180C. Upon reconstitution recombinant human UbcH1 should be stored at 40C between 2-7 days and for future use below -180C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please avoid freeze-thaw cycles. |
| Source Antigen | Recombinant, E. coli |
| Reactivity | |
| Cross Reactivity | |
| Applications | |
| Molecular Weight | 23.4 |
Product Properties
| Storage | -20°C |
| Grade | Highly Purified |
| Purity | ≥ 95% as determined by RP-HPLC, anion-exchange FPLC and/or reducing and non-reducing SDS-PAGE Silver Stained gel. |
| Form | Supplied as a lyophilized powder in 1X PBS, 1mM DTT, pH 7.5. |
| Reactivity Life | 6 months |
| Note | For reserch purpose only |
Target Gene
NA
